PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00999.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 221aa    MW: 23370.8 Da    PI: 9.0088
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00999.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.41.4e-372484262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ++++l+cprC+stntkfCyynny+ sqPr+fCkaCrryWt+GG+lr++PvGg +rk+ k+s
  Rsa1.0_00999.1_g00007.1 24 QQDQLPCPRCESTNTKFCYYNNYNFSQPRHFCKACRRYWTHGGTLRDIPVGGVSRKSSKRS 84
                             57889***************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-29276IPR003851Zinc finger, Dof-type
PfamPF027016.4E-332682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5842882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MPSDLNESRR LTTKMPHVGA VGDQQDQLPC PRCESTNTKF CYYNNYNFSQ PRHFCKACRR  60
YWTHGGTLRD IPVGGVSRKS SKRSRTCSSV AVSTASVGSR EFPLQATPVL FPPSSNDGGV  120
AAAKGSASSV YGGFTSLLSY NAAASRNGPG GGFNGLEGFG LGLGHGSYFD NVRFGQGITV  180
WPFSSSATDA ASAVTSHVGP TPGTWQFEGP ESKVGFVSGD Y
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572512e-31DQ857251.1 Glycine max Dof2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013653583.11e-136PREDICTED: dof zinc finger protein DOF5.8-like
SwissprotQ9FGD61e-114DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A078EH841e-136A0A078EH84_BRANA; BnaA07g12230D protein
STRINGBra012119.1-P1e-135(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.11e-73Dof family protein